Loading...
HomeMy WebLinkAbout2019-03-13 Planning & Zoning PacketAGENDA KENAI PLANNING & ZONING COMMISSION – REGULAR MEETING MARCH 13, 2019 - 7:00 P.M. KENAI CITY COUNCIL CHAMBERS 210 FIDALGO AVENUE, KENAI, ALASKA www.kenai.city 1.ALL TO ORDER a.Pledge of Allegiance b.Roll Call c.Agenda Approval d.Consent Agenda e. *Excused absences *All items listed with an asterisk (*) are considered to be routine and non-controversial by the Commission and will be approved by one motion. There will be no separate discussion of these items unless a Commission Member so requests, in which case the item will be removed from the Consent Agenda and considered in its normal sequence on the agenda as part of the General Orders. 2. *APPROVAL OF MINUTES a.February 27, 2019………………………………………………………………………………1 3.SCHEDULED PUBLIC COMMENT (Public comment limited to ten (10) minutes per speaker) 4.UNSCHEDULED PUBLIC COMMENT (Public comment limited to three (3) minutes per speaker; thirty (30) minutes aggregated) 5.CONSIDERATION OF PLATS - None 6.PUBLIC HEARINGS a.Resolution PZ2019-04 – Application for an Encroachment Permit for an Existing Single-Family Residence Side Yard Setback for the property located at 2730 VIP Drive, Kenai, Alaska, 99611, and further described as Lot 12, Block 3, VIP Ranch Estates Subdivision Part One. The application was submitted by Tom Campanella, 2730 VIP Drive, Kenai, Alaska 99611……………………………………………………………………9 b.Resolution PZ2019-07 – Application for a Conditional Use Permit to operate a Bed and Breakfast and Guide Service located at 1555 Angler Drive, Kenai, Alaska 99611, and further described as Lot 31, Block 1, Anglers Acres Subdivision Part 2. The application was submitted by Evan and Kathy Harding, 1555 Angler Drive, Kenai, Alaska 99611…………………………………………………………………………………………...21 7. UNFINISHED BUSINESS -None 8 . NEW BUSINESS -None 9. PENDING ITEMS -None 10. REPORTS a. City Council ................................................................................................. 39 b. Borough Planning ......................................................................................... 43 c. Administration 11. ADDITIONAL PUBLIC COMMENT (Public comment limited to three (3) minutes per speaker; thirty (30) minutes aggregated) 12. INFORMATIONAL ITEMS 13. NEXT MEETING ATTENDANCE NOTIFICATION -March 27, 2019 14. COMMISSION COMMENTS AND QUESTIONS 15. ADJOURNMENT AGENDA KENAI PLANNING & ZONING COMMISSION -REGULAR MEETING MARCH 13, 2019 -7 :00 P.M . Page 2 of 2 KENAI PLANNING & ZONING COMMISSION REGULAR MEETING FEBRUARY 27, 2019 – 7:00 P.M. KENAI CITY COUNCIL CHAMBERS 210 FIDALGO AVENUE, KENAI, ALASKA CHAIR JEFF TWAIT, PRESIDING MINUTES 1. CALL TO ORDER Commission Chair Twait called the meeting to order at 7:00 p.m. a. Pledge of Allegiance Commission Chair Twait led those assembled in the Pledge of the Allegiance. b. Roll Call Commissioners present: Chair J. Twait, Vice-Chair D. Fikes, R. Springer, G. Greenberg, T. McIntyre, J. Halstead, V. Askin Commissioners absent: Staff/Council Liaison present: City Planner E. Appleby, Deputy City Clerk J. LaPlante, City Attorney S. Bloom, City Clerk J. Heinz, Planning Dept. Assistant W. Anderson, Council Liaison B. Molloy A quorum was present. c. Agenda Approval Chair Twait noted the following revisions to the packet: Add to item 6.a. Resolution No. PZ2019-04 x Correction of Map Add to item 6.b. Resolution No. PZ2019-01 x Staff Memorandum x Six Emails in Support of Resolution x Kenai Police Dispatch Call Records MOTION: Commissioner Halstead MOVED to approve the agenda with the revisions noted and Commissioner Askin SECONDED the motion. There were no objections; SO ORDERED. d. Consent Agenda Page 1 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 2 of 8 February 27, 2019 MOTION: Commissioner Springer MOVED to approve the consent agenda and Commissioner Halstead SECONDED the motion. There were no objections; SO ORDERED. *All items listed with an asterisk (*) are considered to be routine and non-controversial by the Commission and will be approved by one motion. There will be no separate discussion of these items unless a Commission Member so requests, in which case the item will be removed from the Consent Agenda and considered in its normal sequence on the agenda as part of the General Orders. e. *Excused absences – None. 2. *APPROVAL OF MINUTES – January 23, 2018 The minutes were approved by the Consent Agenda. 3. SCHEDULED PUBLIC COMMENT – (10 minutes) None scheduled. 4. UNSCHEDULED PUBLIC COMMENT – (3 minutes) None. 5. CONSIDERATION OF PLATS – None. 6. PUBLIC HEARINGS a. Resolution PZ2019-04 – Application for an Encroachment Permit for an Existing Single- Family Residence Side Yard Setback for the property located at 2730 VIP Drive, Kenai, Alaska, 99611, and further described as Lot 12, Block 3, VIP Ranch Estates Subdivision Part One. The application was submitted by Tom Campanella, 2730 VIP Drive, Kenai, Alaska 99611 The City Planner reviewed the staff report as provided in the meeting packet and specifically noted the as-built survey disclosed the attached garage on the single-family residence encroached into the side yard setback. She added that in 2009 a building permit was issued to enclose the carport and there was an error in measurements or development of the site plan. The City Planner noted that there was a clerical error in the notices for this action, and to allow proper notice with correct information, it was recommended this item be postponed to the next meeting for the purpose of holding another public hearing. The City Planner summarized that the applicant met the criteria for issuance of an Encroachment Permit set forth in the Kenai Municipal code, subject to the following conditions: x Applicant must comply with all federal, State of Alaska, and local regulations; and x Pursuant to KMC 14.20.185(g), this permit shall expire automatically upon termination or interruption of the use; damage to the building, structure, or object which makes it uneconomic to repair the building, structure, or object; or, the expiration of the useful life of the building, structure, or object, whichever comes first. Page 2 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 3 of 8 February 27, 2019 MOTION: Chair Twait MOVED to postpone Resolution No. PZ2019-04 to the next Commission Meeting on March 13 to allow proper notice with corrections, and Commissioner Halstead SECONDED the motion. There being no objection; SO ORDERED. b. Resolution PZ2019-01 – Application for a Conditional Use Permit to operate a Boarding House located at 160 Phillips Drive, Kenai, Alaska 99611, and further described as Lot 9, Block 8, Valhalla Heights Subdivision Part 3. The application was submitted by Perry and Sheryl Neel, P.O. Box 1075, Kasilof, Alaska 99610 The City Planner reported that staff found the applicant meets the criteria for issuance of a conditional use permit and recommended approval of the application for the use of a boarding house, subject to the following conditions: x Applicant must comply with all federal, State of Alaska, and local regulations; x Applicant will file an annual report for the Conditional Use Permit as set forth in Kenai Municipal Code 14.20.150(f) prior to the 31st day of December of each year; x Applicant will include a copy of the house rules as part of their annual Conditional Use Permit report to the City; x Applicant will report the number of residents living on the property and the typical number of vehicle kept on the property as part of their annual Conditional Use Permit report to the City; x No more than five people may live in the boarding house at any given time (the number of people includes both the caretaker and paying residents); and x The residence, driveway, and yard must be kept neat in appearance. MOTION: Commissioner Springer MOVED to approve Resolution No. PZ2019-04 and Commissioner Askin SECONDED the motion. Chair Twait opened the floor for public testimony. Perry Neel, owner, explained that he was a part of the Wildwood prison ministry team and a mentor in the re-entry program to transition inmates back into society. He noted that there was an ongoing need for transition programs for people being released from prison. Mr. Neel added he and his wife purchased the home in 2011 with the intent to offer it as a means for transition, with rules in place. The home had been used for this type of assistance since 2012 as he was unaware he needed a conditional use permit. He clarified that there were five bedrooms, six beds, and Mika Reems was the current house manager, offering supervision on behalf of the owners, enforcing house rules, and the residents were to remain in compliance with their conditions for release. He further noted they have a weekly bible study, a potluck the evening of fellowship, and are required to show positive efforts of moving forward. Virginia Turner expressed opposition to the application noting she was a former correctional officer, and did not feel comfortable living there. She added t hat she wanted the owner or manager onsite 100 percent of the time. Charles Ray Reeves, expressed gratitude to owners’ efforts to help but opposed the location of Page 3 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 4 of 8 February 27, 2019 the current halfway/boarding house. He further noted he backed out of the purchase of the property based on the interactions he has had with those that live in the halfway/boarding house. Craig Thomsen expressed gratitude toward the owners’ efforts, but opposed the house in this neighborhood. Mr. Thomsen read from the Kenai Municipal Code about intent of a Rural Residential zone. He noted that this type of home use was in violation of residential code, depreciated the value of his home, and affected his health and safety. He recommended that the City Planner speak to patrol officers regarding the call volume and response times to that house. Jeff Landrum spoke in support of the Conditional Use Permit noting he was a former inmate. He expressed appreciation to the owners and their help in his transition. He noted he was in the house for 7 months; the home was clean, safe and a proactive environment; it was a well- organized and faith-based home; and the manager was there continually, very interactive with the residents. Mr. Landrum stated he was now a foreman electrician, and Mr. Neel’s house was an instrumental part of his recovery. Mika Reems spoke in support of the application and reported that he moved in, in July 2017. He explained that he worked a part-time job, made regular contact with each resident of the house each day, there were strict rules in place that had to be followed, and parole officers stopped by for random check-ins. Mr. Reems added that he saw a positive transition of people at the house leaving as a productive citizen on their own. Cathy Campbell expressed concern with this type of housing and questioned if staff had substance abuse training or similar to meet the potential need in an emergency. She further expressed concern with living in a neighborhood with this type of housing. Jake Gibbs spoke in support of the permit stating he managed the house, full-time, from approximately May 2013 to February 2018. He added that it was a safe place for men in need that offered hope, compassion, positive encouragement and a second chance. Cheryl Russell spoke in opposition of the application, noting there was increased drug use in that neighborhood, and she had concern for the incoming families with young children moving to that area. Tim Barber spoke in support of the permit and expressed appreciation of the efforts by Mr. Neel and his wife. Mr. Barber explained he was not in prison but moved to Kenai from Virginia with nowhere to live and Mr. Neel offered him this home and gave him a chance to go in the right direction, and obtain a good job. Mr. Barber noted the owners care about the residents and he was thankful for what they do. He added that he had seen a few residents return to Wildwood, but this was an opportunity for a second chance to those that wanted positive change. Loretta Pierce spoke in opposition of a boarding house and noted that she did not know it was already acting as one. Ms. Pierce expressed concern with conditional use permit applicants only receiving minimal reprimand for not having one in place. She stated she wanted the missed conditional use permits to be looked into and receive penalty. Ms. Pierce added that the neighborhood had much more foot traffic. Ed Marsh spoke in support of the owners’ efforts and supported the boarding house. He explained that he had been carrying the Alcoholics Anonymous message at the prison for several years and was a part of the Kairos Prison Ministry. He stated that the path of least resistance is drugs and Page 4 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 5 of 8 February 27, 2019 alcohol. Mr. Marsh noted the need for a place to transition from prison and a positive environment for change. Michael Lavelly spoke in support of the permit. He expressed understanding to the public concerns about not wanting places like a boarding house, or a daycare, or similar businesses in in their neighborhoods even though it is agreed there is need. He clarified that, though he was a member of Kairos Prison Ministry, he had been to jail and homeless in his life and without compassionate people like Mr. Neel and his wife, these men would have little chance for change. Alison Bushnell, Housing Specialist at Love Inc., spoke in support of the application and stated that one of biggest struggles they face is housing. She noted that this house has helped with struggles of homelessness or men transitioning from prison needing placement. Ms. Bushnell stated Mr. Neel, his wife and this house was an asset to community. She clarified it was not built to be a typical emergency shelter; it offered a home and accountability with the lease contract. Jennifer Thomsen thanked the owners for their efforts but expressed concern about the lack of municipal code controlling this specific type of house and the limitations in the future and potential increase of these types of houses, interrupting rural harmony. Grant Shuman spoke in support of the application and stated he lived in the house. He expressed gratitude for the life change that could not have been possible without the love, support, and home by the owners. He noted he was introduced by Love, Inc. and clarified there was no specific process to be eligible to live in the house. Dennis Murray expressed support for the application and noted it was not for profit work, it was mission work. He noted that it sounded like there were more problems and increased concern in the neighborhood due to the undeveloped lots. He added that he hopes to see the community/neighborhood work together to help these people. Mr. Murray pointed out that there was a Freedom House for women in Soldotna and another home similar for men being opened in Soldotna. He suggested that this was not a halfway house. Clyde Crandall spoke in support of the permit and stated he was a Kairos Prison Ministry member and a part of the ministry for five years. He stated he has had many dealings with the house transition program and helped establish rules at the home. Mr. Crandall noted the owners were helping fulfill a need in the community; not for profit. He added that he deals with the residents regularly to make a positive difference in their lives and the community. He added that he supported building more if it was an option. There being no one else wishing to be heard, public comment was closed. Perry Neel clarified that the back-up plan, in the absence of a house manager, was the longest resident/senior in the house. Mr. Neel noted that there was approximately six months without a house manager, and he was there more often and the senior resident helped. Clarification was provided regarding the vetting process, which included contact by Love, Inc., probation officers, or homeless people recommended by Love, Inc. Mr. Neel noted they now ask about mental stability, and if a sex offender to ensure they are registered but does not discriminate. He further clarified that there was no curriculum, other than bible study and it was not a halfway house. He added that he would be open to do background check on a homeless person that has no history from Wildwood or parole officer. Page 5 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 6 of 8 February 27, 2019 MOTION TO AMEND: Commissioner Springer MOVED to amend Condition No. 5 to say, “No more than six people, to include on-site manager…”; Commissioner Halstead SECONDED the motion. It was noted that parking spaces should meet Kenai Municipal Code requirements with the number of people in the home. VOTE ON THE AMENDMENT: YEA: Twait, Askin, Halstead, Greenberg, Fikes, Springer NAY: McIntyre MOTION PASSED. MOTION TO AMEND: Commissioner Springer MOVED to amend the conditions to include an annual building inspection by the City to confirm it is a safe living environment and Commissioner Askin SECONDED the motion. VOTE ON THE AMENDMENT: YEA: Askin, McIntyre, Greenberg, Fikes, Springer, Twait NAY: Halstead MOTION PASSED. MOTION TO AMEND: Commissioner McIntyre MOVED to add a Condition 8. Parking spaces be provided in accordance with Kenai Municipal Code regulated parking for a boarding house, and Commissioner Fikes SECONDED the motion. There was discussion regarding the ability to defer from municipal code requirements. Commissioner Fikes noted she found that the conditions were met, she agrees with an annual inspection and would be voting in favor. The City Planner reiterated that the house rules were provided in the application and a required condition of approval. It was clarified that State statute requires that the location of sex offenders be made known and that there was a State website, tracking the locations of sex offenders. Chair Twait noted the fact that the house had been operating for 6 years and, if approved, would have more requirements in place; he would be voting in favor. Commissioner Greenberg agreed that it could be uncomfortable for neighbors but the business practices were focused on and it aligned with the requirements of a conditional use permit; he Page 6 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 7 of 8 February 27, 2019 would be voting in favor. VOTE ON THE AMENDMENT: YEA: Askin, McIntyre, Greenberg, Fikes, Springer, Twait, Halstead NAY: MOTION PASSED UNANIMOUSLY. VOTE ON MAIN MOTION AS AMENDED: YEA: Askin, Springer, Halstead, McIntyre, Fikes, Twait, Greenberg NAY: MOTION PASSED UNANIMOUSLY. Chair Twait noted there was a 15-day appeal period. 7. UNFINISHED BUSINESS – None. 8. NEW BUSINESS – None. 9. PENDING ITEMS – None. 10. REPORTS a. City Council – Council Member Molloy reviewed the action agenda from the January 16 and February 6 City Council Meetings and two work sessions. He specifically noted Council and Administration met with Capital Management Partners to discuss the Permanent Fund. He clarified the Bowling Alley and its balloon payment has been ongoing discussion. U-Haul purchased the old Lowes building but plans and revenues to the City of Kenai are unknown. b. Borough Planning – Vice-Chair Fikes reported the Commission met on February 25 and approved an Ordinance for a Memorandum of Understanding (MOU) between the State of Alaska, Department of Transportation and Kenai Peninsula Borough regarding the Kenai escape route; there was a public hearing that approved a land use permit for gravel extraction, noting it was a second time around, as there was concern regarding the requirements for berms around the property. c. Administration – City Planner Appleby reported on the following: x She provided the January 2019 Report in the packet; and x Tomorrow is release date for draft EIS to be released for the Alaska LNG Project. 11. ADDITIONAL PUBLIC COMMENT Virginia Turner suggested working together to develop a section in Code for the future that clarifies the difference between private property and a true boarding house. Page 7 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission ___________________________________________________________________________________ Planning and Zoning Commission Meeting Page 8 of 8 February 27, 2019 Charles Reeves inquired about the Bowling Alley and purpose for the old Lowes Building. He thanked the Commission for the discussion. 12. INFORMATIONAL ITEMS a. January 2019 Planning and Zoning Department Report City of Kenai Bicycle Friendly Community Report Card 13. NEXT MEETING ATTENDANCE NOTIFICATION – March 13, 2019 City Planner noted she planned on work sessions prior to regular meetings until the summer. 14. COMMISSION COMMENTS & QUESTIONS Commissioner thanked the public for their attendance and testimony. 15. ADJOURNMENT There being no further business before the Commission, the meeting was adjourned at 10:07 p.m. Minutes prepared and submitted by: ____________________________ Jacquelyn LaPlante Deputy City Clerk Page 8 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission STAFF REPORT To: Planning & Zoning Commission Date: February 27, 2019 Subject: Resolution PZ2019-04 – Encroachment Permit GENERAL INFORMATION Applicant:Tom Campanella 2730 VIP Drive Kenai, Alaska 99611 Requested Action:Encroachment Permit Legal Description:Lot 12, Block 3, VIP Ranch Estates Subdivision Part One (1) Property Address:2730 VIP Drive KPB Parcel No:04940013 Lot Size:42,253 square feet (0.97 acres) Existing Zoning:Rural Residential (RR) Current Land Use:Single Family Dwelling Land Use Plan:Low Density Residential ANALYSIS The applicant submitted an application for an encroachment permit because an as-built survey prepared on January 19, 2019, discloses that the attached garage for the single-family residence located on the premises encroaches into the side yard setback. The Rural Residential (RR) Zone requires a fifteen foot (15’) side yard setback, as set forth in Kenai Municipal Code (KMC) 14.24 Development Requirements Tables. The as-built survey shows the garage to be located 10.3 feet from the property line. The garage encroaches into the side yard setback on the southern boundary of the property. A single-family residence, including a carport, was constructed in 1977 on the property. The carport was enclosed in 2008. On May 26, 2009, a building permit was issued to the applicant for an addition to the carport. The site plan submitted with the application for the building permit indicated that the carport met the side yard setback requirement for the Rural Residential Zone. It appears that there was an error in measuring the distance from the property line during construction of the addition to the carport. Page 9 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission PZ2019-04 Staff Report Page 2 KMC 14.20.185(a)(b)(c) details the definition, intent, and permit application process for encroachment permits. City staff deemed the application to be complete and the City is in receipt of the application fee. Pursuant to KMC 14.20.280, Public hearing and notifications, City staff published notice of the public hearing twice in the Peninsula Clarion, sent notification to real property owners within three-hundred-feet (300’) of the affected parcel, and the applicant posted notice of the application for an encroachment permit on the parcel. The intent of an encroachment permit is to relax development requirements to remedy encroachments and nonconforming uses which satisfy the requirements of financial institutions and which do not fall under KMC 14.20.050, Nonconforming lots, structures, and uses. KMC 14.20.185(d) Encroachment Permits Review Criteria states four conditions that the Planning and Zoning Commission must deem to exist when establishing findings prior to issuing an encroachment permit: x KMC 14.20.185(d)(1) An encroachment as defined in subsection (a) exists. Condition Exists: Subsection (a) defines an encroachment as any object or structure above or below ground and constructed or located in a manner other than set forth in the Development Requirements Table. The garage was constructed above ground and into the side yard setback as set forth in KMC 14.24 Development Requirements Table and an encroachment exists. x KMC 14.20.185(d)(2) The encroachment does not encroach upon a Federal, State or City right-of-way or utility easement. Condition Exists: The structure faces VIP Drive, a City-maintained road. The utility easements are located within the front ten feet (10’) of the property line adjacent to the right-of-way for VIP Drive. Therefore, the structure does not encroach onto a right-of-way or utility easement. x KMC 14.20.185(d)(3) The issuance of the encroachment permit will not authorize a use which is a not a principal permitted use in the zoning district in which the property is located. Condition Exists: A single-family dwelling, defined as a building or any portion thereof designed for residential occupancy with one dwelling unit, is a principal permitted use in the Rural Residential Zone. Accessory buildings are considered part of the main building when connected by a common wall, as is the case with the attached garage. x KMC 14.20.185(d)(4) The encroachment is not located across a platted lot line. Condition Exists: The encroachment does not cross a platted lot line. Building Official Comments: There is sufficient separation from the property line and no changes in construction will be required. RECOMMENDATIONS City staff find that the applicant meets the criteria for issuance of an Encroachment Permit as set forth in subsections (d)(1) through (d)(4) of Kenai Municipal Code 14.20.185, and hereby recommends that the Planning and Zoning Commission approve the encroachment permit application, subject to the following conditions: Page 10 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission PZ2019-04 Staff Report Page 3 1. Applicant must comply with all federal, State of Alaska, and local regulations. 2. Pursuant to KMC 14.20.185(g), this permit shall expire automatically upon termination or interruption of the use; damage to the building, structure, or object which makes it uneconomic to repair the building, structure, or object; or, the expiration of the useful life of the building, structure, or object, whichever comes first. ATTACHMENTS A. Resolution No. PZ2019-04 B. Encroachment Permit Application C. As-built D. Map Page 11 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission           &,7<2).(1$, 3/$11,1*$1'=21,1*&200,66,21 5(62/87,21123= (1&52$&+0(173(50,7  $5(62/87,212)7+(3/$11,1*$1'=21,1*&200,66,212)7+(&,7<2) .(1$,*5$17,1*$5(48(67)25$1(1&52$&+0(173(50,772  1$0(720&$03$1(//$ 86((1&52$&+0(17 3(50,7 ± )25 (;,67,1* 6,1*/()$0,/<5(6,'(1&( 6,'(<$5'6(7%$&. /2&$7('   9,3 'ULYH .HQDL $ODVND /RW  %ORFN  9,3 5DQFK (VWDWHV 6XEGLYLVLRQ3DUW2QH  6WUHHW$GGUHVV/HJDO'HVFULSWLRQ   .(1$,3(1,168/$%2528*+3$5&(/12  :+(5($6WKH&RPPLVVLRQILQGV   $QDVEXLOWVXUYH\GDWHG-DQXDU\GLVFORVHVDVWUXFWXUHDSSUR[LPDWHO\ IHHWIURPWKHSURSHUW\OLQHDQHQFURDFKPHQWRIIHHWLQWRWKHVLGH\DUGVHWEDFN DQG   $QDSSOLFDWLRQPHHWLQJWKHUHTXLUHPHQWVRI6HFWLRQ F ZDVVXEPLWWHGDQG UHFHLYHGRQ-DQXDU\DQG   7KLVUHTXHVWLVRQODQG]RQHGDV5XUDO5HVLGHQWLDO 55 ZLWKLQWKH&LW\RI.HQDLDQG   $QHQFURDFKPHQWH[LVWVDVGHILQHGLQ.0& D WREHDVWUXFWXUHORFDWHGLQ DPDQQHURWKHUWKDQVHWIRUWKLQWKH'HYHORSPHQW5HTXLUHPHQWV7DEOHPHHWLQJWKH UHTXLUHPHQWVRI.0& G  DQG   7KHHQFURDFKPHQWGRHVQRWHQFURDFKXSRQDIHGHUDO6WDWHRU&LW\ULJKWRIZD\RU XWLOLW\HDVHPHQWDVXWLOLW\HDVHPHQWVDUHORFDWHGZLWKLQWKHIURQWWHQIHHW ¶ RIWKH SURSHUW\DGMDFHQWWRWKHULJKWRIZD\IRUWKH&LW\PDLQWDLQHG9,3'ULYHDVUHTXLUHG )LGDOJR$YHQXH.HQDL$ODVND 7HOHSKRQH)D[ ZZZNHQDLFLW\ Page 12 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 5HVROXWLRQ1R3= 3DJHRI  E\.0& G  DQG   $VLQJOHIDPLO\GZHOOLQJLVDSULQFLSDOSHUPLWWHGXVHLQWKH5XUDO5HVLGHQWLDO=RQHDQG WKHLVVXDQFHRIWKHHQFURDFKPHQWSHUPLWZLOOQRWDXWKRUL]HDXVHZKLFKLVQRWD SULQFLSDOSHUPLWWHGXVHLQWKH]RQLQJGLVWULFWLQZKLFKWKHSURSHUW\LVORFDWHGDV UHTXLUHGE\.0& G  DQG   7KH HQFURDFKPHQW GRHV QRW FURVV D SODWWHG ORW OLQH DV UHTXLUHG E\ .0&  G  DQG   $GXO\DGYHUWLVHGSXEOLFKHDULQJDVUHTXLUHGE\.0&ZDVFRQGXFWHGE\ WKH&RPPLVVLRQRQ)HEUXDU\  12: 7+(5()25( %( ,7 5(62/9(' %< 7+( 3/$11,1* $1' =21,1* &200,66,212)7+(&,7<2).(1$,7+$77+($33/,&$17+$6'(021675$7(' 7+$77+(352326(''(9(/230(170((767+(&5,7(5,$)256$,'3(50,7 $1' 7+(5()25( 7+( &200,66,21'2(6 $87+25,=( 7+( $'0,1,675$7,9( 2)),&,$/72,668(7+($335235,$7(3(50,768%-(&7727+()2//2:,1* &21',7,216   $SSOLFDQWPXVWFRPSO\ZLWKDOOIHGHUDO6WDWHRI$ODVNDDQGORFDOUHJXODWLRQV   3XUVXDQW WR .0&  J  WKLV SHUPLW VKDOO H[SLUH DXWRPDWLFDOO\ XSRQ WHUPLQDWLRQRULQWHUUXSWLRQRIWKHXVHGDPDJHWRWKHEXLOGLQJVWUXFWXUHRUREMHFW ZKLFK PDNHV LW XQHFRQRPLF WR UHSDLU WKH EXLOGLQJ VWUXFWXUH RU REMHFW RU WKH H[SLUDWLRQRIWKHXVHIXOOLIHRIWKHEXLOGLQJVWUXFWXUHRUREMHFWZKLFKHYHUFRPHVILUVW  3$66('%<7+(3/$11,1*$1'=21,1*&200,66,212)7+(&,7<2).(1$, $/$6.$21)(%58$5<   &+$,53(5621BBBBBBBBBBBBBBBBBBBBBBBBB$77(67  -HII7ZDLW -DPLH+HLQ] &KDLUSHUVRQ&LW\&OHUN  Page 13 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 14 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 15 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 16 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 17 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 18 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission V.I.P. RANCH ESTATESPART 1TES V.I.P. COUNTRY ESTATES PART 5 ALEXVE S P A R T 7 HANNAH EST V.I. V V.I.P. C O U N T R Y E S T A T E S P A RT 4 B E 2014 REPLAT 6 5 7 5 4 7 107 1 14 15 1 14 10 3 2 28 2 67 3 9 9 7-A 18 3 1 86 8 9 13 8A 14 8 9 15 12 10 11 12 13 10 12 13 17 6-A 11 13 18 14 11 16 16 15 17 1 (4) (3) (2) (3) (3) (2) (2)2745275527452755845845 83 0 850 83 0 85000 480 460 725 51025852755255525506102 6 0 0 2 5 6 0 620615 27057352715272027252730273527452748485 480 460 725 2585255 52550610 2 6 0 0 2 5 6 0 620615 2705735271527202725273027352748540 48526252620263582 0 810 808 750 740 815 755 745 271027202725273527302745274027552750840 810 750 740 835 825 815 278026252620263582 0 810 808 750 740 815 755 745 271027202725273527302745274027552750840 810 750 835 825 815 27802 6 1 5 26 2 6 1 5 26 TCTEEN AVE R SET N E T D R SET NET DR KALIFORNSKY BEACH RDSEINE STCEBALEEN AVE T 2745275527452755845845 83 0 850 83 0 85000 480 460 725 51025852755255525506102 6 0 0 2 5 6 0 620615 27057352715272027252730273527452748485 480 460 725 2585255 52550610 2 6 0 0 2 5 6 0 620615 2705735271527202725273027352748540 48526252620263582 0 810 808 750 740 815 755 745 271027202725273527302745274027552750840 810 750 740 835 825 815 278026252620263582 0 810 808 750 740 815 755 745 271027202725273527302745274027552750840 810 750 835 825 815 27802 6 1 5 26 2 6 1 5 26 . 250 ' Date: 2/20/2019 The information depicted here on is for graphic representation only of the best available sources. The City of Kenai assumes no responsibility for errors on this map. 1 inch equals 250 feet Lot 12, Block 3 VIP Ranch Estates Part 1 BALEEN AVENUEVIP DRIVEPage 19 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission THIS PAGE INTENTIONALLY LEFT BLANK Page 20 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission  67$))5(3257 7R3ODQQLQJ =RQLQJ&RPPLVVLRQ 'DWH0DUFK 6XEMHFW5HVROXWLRQ3=±&RQGLWLRQDO8VH3HUPLWIRU%HGDQG%UHDNIDVW*XLGH 6HUYLFHV  *(1(5$/,1)250$7,21  $SSOLFDQW(YDQDQG.DWK\+DUGLQJ $QJOHU'ULYH .HQDL$ODVND 5HTXHVWHG$FWLRQ&RQGLWLRQDO8VH3HUPLW±%HGDQG%UHDNIDVWDQG*XLGH 6HUYLFH /HJDO'HVFULSWLRQ/RW%ORFN$QJOHUV$FUHV6XEGLYLVLRQ3DUW 3URSHUW\$GGUHVV$QJOHU'ULYH .3%3DUFHO1R /RW6L]HVTXDUHIHHW DFUHV  ([LVWLQJ=RQLQJ5XUDO5HVLGHQWLDO 55  &XUUHQW/DQG8VH6LQJOH)DPLO\'ZHOOLQJ /DQG8VH3ODQ/RZ'HQVLW\5HVLGHQWLDO  $1$/<6,6  ,Q0D\RIWKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQIRUWKH&LW\RI.HQDLJUDQWHG&RQGLWLRQDO 8VH3HUPLW3=IRUWKLVORFDWLRQ7KHDSSOLFDQWVFRPSOLHGZLWKWKHWHUPVDQGFRQGLWLRQVRI WKH&RQGLWLRQDO8VH3HUPLWIURPWKURXJK,QWKHDSSOLFDQWVLQIRUPHGWKH&LW\ WKDWWKH\GLGQRWFRQGXFWEXVLQHVVLQDQGGLGQRWLQWHQGWRRSHUDWHLQ&RQGLWLRQDO8VH 3HUPLW3=H[SLUHGSXUVXDQWWR.HQDL0XQLFLSDO&RGH .0&  L  ZKLFKVWDWHV WKHIROORZLQJ³$FRQGLWLRQDOXVHSHUPLWVKDOODXWRPDWLFDOO\H[SLUHLIIRUDQ\UHDVRQWKHFRQGLWLRQDO XVHFHDVHVIRUDSHULRGRIRQH  \HDURUORQJHU´  7KHVXEMHFWSDUFHOLVORFDWHGLQWKH5XUDO5HVLGHQWLDO 55 =RQHRIWKH&LW\RI.HQDL.0& /DQG8VH7DEOHGHQRWHVWKHODQGXVHVRI%HGDQG%UHDNIDVWDQG*XLGH6HUYLFHDV FRQGLWLRQDOXVHVZLWKLQWKH55=RQH7KHDSSOLFDQWVLQWHQGWRRSHUDWHWKLV\HDUDQGKDYHDSSOLHG IRUDQHZFRQGLWLRQDOXVHSHUPLWIRUWKHXVHVRI%HGDQG%UHDNIDVWDQG*XLGH6HUYLFH.0& 'HILQLWLRQVJLYHVWKHIROORZLQJGHILQLWLRQVIRUWKHSURSRVHGXVHV Page 21 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 3=6WDII5HSRUW3DJH ³%HGDQG%UHDNIDVW´PHDQVDUHVLGHQWLDORZQHURFFXSLHGGZHOOLQJLQZKLFKURRPVDUH UHQWHGWRSD\LQJJXHVWVRQDQRYHUQLJKWEDVLVZLWKQRPRUHWKDQRQH  PHDOVHUYHG GDLO\  ³*XLGH 6HUYLFH´ PHDQV DQ\ DFWLYLW\ RQ DQ\ SUHPLVHV XVHG IRU FROOHFWLQJ RU UHWXUQLQJ SHUVRQVIURPUHFUHDWLRQDOWULSVZKHQUHPXQHUDWLRQLVSURYLGHGIRUWKHVHUYLFH  7KH SURSRVHG XVH PHHW WKHVH GHILQLWLRQV IRU EHG DQG EUHDNIDVW DQG JXLGH VHUYLFH 7KH ILYH EHGURRPKRXVHZLOOEHRZQHURFFXSLHG7KHDSSOLFDQWVSODQWRUHQWWKHORZHUWZREHGURRPVDVD EHGDQGEUHDNIDVWDQGWRKDYHERDWJXLGHVSLFNXSJXHVWVVWD\LQJDWWKHEHGDQGEUHDNIDVWGLUHFWO\ IURPWKHLUGRFN7KHDSSOLFDQWVKDYHDQDSSURSULDWHEXVLQHVVOLFHQVHIRUWKHSURSRVHGXVHV  .0& E GHWDLOVDSSOLFDWLRQUHTXLUHPHQWVIRUFRQGLWLRQDOXVHSHUPLWV&LW\VWDIIGHHPHG WKHDSSOLFDWLRQWREHFRPSOHWHDQGWKH&LW\LVLQUHFHLSWRIWKHDSSOLFDWLRQIHH3XUVXDQWWR.0& 3XEOLFKHDULQJDQGQRWLILFDWLRQV&LW\VWDIISXEOLVKHGQRWLFHRIWKHSXEOLFKHDULQJWZLFH LQWKHPeninsula ClarionVHQWQRWLILFDWLRQWRUHDOSURSHUW\RZQHUVZLWKLQWKUHHKXQGUHGIHHW ¶  RIWKHDIIHFWHGSDUFHODQGQRWLILFDWLRQwasSRVWHGon the property1RSXEOLF FRPPHQWVKDYHEHHQVXEPLWWHGWRWKH&LW\DERXWWKHDSSOLFDWLRQDVRI0DUFK  &LW\&RGHIRU&RQGLWLRQDO8VH3HUPLWV  3XUVXDQWWR.0& D WKHLQWHQWRIDFRQGLWLRQDOXVHSHUPLWLVWRDOORZVRPHXVHVWKDW PD\EHFRPSDWLEOHZLWKWKHGHVLJQDWHGSULQFLSDOXVHVLQVSHFLILF]RQLQJGLVWULFWVSURYLGHGFHUWDLQ FRQGLWLRQV DUH PHW .0&  G  &RQGLWLRQDO 8VH 3HUPLWV 5HYLHZ &ULWHULD VWDWHV VL[ FRQGLWLRQV WKDW WKH 3ODQQLQJ DQG =RQLQJ &RPPLVVLRQ PXVW GHHP WR H[LVW ZKHQ HVWDEOLVKLQJ ILQGLQJVSULRUWRLVVXLQJDFRQGLWLRQDOXVHSHUPLW  xKMC 14.20.150(d)(1) The use is consistent with the purpose of this chapter and the purposes and intent of the zoning district. &RQGLWLRQ([LVWV7KHVXEMHFWSDUFHOLVZLWKLQWKH55=RQH3XUVXDQWWR.0& WKHLQWHQWRIWKH]RQHLVIRUORZGHQVLW\UHVLGHQWLDOGHYHORSPHQWLQDQDWWUDFWLYH UHVLGHQWLDOHQYLURQPHQWWRSURKLELWXVHVZKLFKZRXOGYLRODWHWKHUHVLGHQWLDOFKDUDFWHURI WKHHQYLURQPHQWRUJHQHUDWHKHDY\WUDIILFLQDSUHGRPLQDQWO\UHVLGHQWLDODUHDDQGWR VHSDUDWHUHVLGHQWLDOVWUXFWXUHVLQRUGHUWRSUHYHQWKHDOWKKD]DUGVDQGSUHVHUYHWKHUXUDO RSHQTXDOLW\RIWKHHQYLURQPHQW  3URSHUW\RZQHUVKDYHHVWDEOLVKHGVLPLODUEXVLQHVVHVDVVRFLDWHGZLWKILVKLQJDQG WRXULVPDORQJ$QJOHU'ULYHGXHWRLWVSUR[LPLW\WRWKH.HQDL5LYHU7KHUHDUH DSSUR[LPDWHO\SDUFHOVDORQJ$QJOHU'ULYHDQGRIWKHSURSHUW\RZQHUVKDYHEHHQ JUDQWHGFRQGLWLRQDOXVHSHUPLWVE\WKH&LW\RI.HQDLWRRSHUDWHEXVLQHVVHVDVVRFLDWHG ZLWKILVKLQJDQGWRXULVP HJFDELQUHQWDOVEHGDQGEUHDNIDVWHVWDEOLVKPHQWVORGJHV DQGJXLGHVHUYLFHV 7KHDSSOLFDWLRQQRWHVQHLJKERUVKDYHORGJLQJDQGEHGDQG EUHDNIDVWFRQGLWLRQDOXVHSHUPLWVIURPWKH&LW\  7KHVXEMHFWSURSHUW\LVORFDWHGDWWKHVRXWKHUQHQGRI$QJOHU'ULYH7KHWKUHHVWRU\ VWUXFWXUHFRPSOLPHQWVWKHQHLJKERUKRRGVXUURXQGLQJVZLWKWKHH[WHULRUSDLQWHGLQHDUWK WRQHVZLWKDPHWDOURRI$GHTXDWHSDUNLQJLVDYDLODEOHRQWKHSURSHUW\IRUWKHXVHDQG WKHXVHZRXOGQRWJHQHUDWHKHDY\WUDIILF  xKMC 14.20.150(d)(2) The value of the adjoining property and neighborhood will not be Page 22 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 3=6WDII5HSRUW3DJH significantly impaired. &RQGLWLRQ([LVWV7KHUHDUHVLPLODUEXVLQHVVHVDVVRFLDWHGZLWKILVKLQJDQGWRXULVPLQWKH QHLJKERUKRRG7KHDGMRLQLQJSDUFHOWRWKHQRUWKRIWKHVXEMHFWSURSHUW\LV5LGGOHV )LVKLQJ/RGJHDQGWKHSDUFHOWRWKHZHVWLV.DKWQX)ODWV,QQ7KHSDUFHOWRWKHVRXWKLV RZQHGE\&XUWDQG'HEUD6KXH\ZKRKDYHSODQVWRVHOOWKHSURSHUW\WRWKH6WDWHRI $ODVNDIRUKDELWDWSURWHFWLRQ7KH.HQDL5LYHUERUGHUWKHHDVWHUQHGJHRIWKHVXEMHFW SURSHUW\  xKMC 14.20.150(d)(3) The proposed use is in harmony with the Comprehensive Plan. &RQGLWLRQ([LVWV 7KHSURSRVHGXVHLVLQOLQHZLWKJRDOVDQGREMHFWLYHVLGHQWLILHGLQWKH&RPSUHKHQVLYH 3ODQLQFOXGLQJDQREMHFWLYHIRU*RDO(FRQRPLF'HYHORSPHQWWRFDSLWDOL]HRQWKHWRXULVP LQGXVWU\7KLVXVHZRXOGQRWFRQIOLFWZLWKREMHFWLYHVLQ*RDO(QYLURQPHQWDO5HVRXUFHV WRSURWHFWWKH.HQDL5LYHU  xKMC 14.20.150(d)(4) Public services and facilities are adequate to serve the proposed use. &RQGLWLRQ([LVWV7KHSURSHUWLHVORFDWHGDORQJ$QJOHU'ULYHDUHVHUYLFHGE\ZHOODQG VHSWLFQDWXUDOJDVHOHFWULFLW\DQGWHOHSKRQHVHUYLFHV$QJOHU'ULYHLVDSDYHGURDG ZKLFKLVPDLQWDLQHGE\WKH&LW\RI.HQDL7KHDSSOLFDQWVXEPLWWHGGRFXPHQWDWLRQIURP WKH$ODVND'HSDUWPHQWRI(QYLURQPHQWDO&RQVHUYDWLRQWKDWLQGLFDWHVWKHVHSWLFV\VWHP ZDVLQVWDOOHGE\DFHUWLILHGLQVWDOOHUDQGLVVXIILFLHQWWRPHHWVWKHQHHGVRIDILYH EHGURRPKRXVH7KHDSSOLFDQWVPHHW&LW\&RGHUHTXLUHPHQWVWRKDYHWKUHHSDUNLQJ VSDFHV  xKMC 14.20.150(d)(5) The proposed use will not be harmful to the public safety, health or welfare. &RQGLWLRQ([LVWV7KHXVHRIDEHGDQGEUHDNIDVWDQGJXLGHVHUYLFHZLOOQRWEHKDUPIXOWR WKHSXEOLFVDIHW\KHDOWKRUZHOIDUH$EHGDQGEUHDNIDVWDQGJXLGHVHUYLFHZDV SUHYLRXVO\RSHUDWHGIURPWKLVORFDWLRQDQGWKHUHZHUHQRWDQ\KDUPIXOHIIHFWVWRSXEOLF VDIHW\KHDOWKRUZHOIDUH  xKMC 14.20.150(d)(6) Any and all specific conditions deemed necessary by the Commission to fulfill the above-mentioned conditions should be met by the applicant. These may include, but are not limited to, measures relative to access, screening, site development, building design, operation of the use and other similar aspects related to the proposed use 6HHDVXPPDU\RIDSSURYDOFRQGLWLRQVXQGHUWKH5HFRPPHQGDWLRQVHFWLRQ$SSURYDO FRQGLWLRQVDGGUHVVILUHVDIHW\DQGUHSRUWLQJUHTXLUHPHQWV7KHFRQGLWLRQRIOLPLWLQJWKH QXPEHURIERDWVWRWKUHHZDVDFRQGLWLRQRI3=WKHH[SLUHGFRQGLWLRQDOXVHSHUPLW IRUWKHVXEMHFWSURSHUW\IRUWKHVDPHXVH7KLVFRQGLWLRQZDVJLYHQWROLPLWFKDQJHVWR WKHFKDUDFWHURIWKHQHLJKERUKRRGDQGLVFRQVLVWHQWZLWKOLPLWDWLRQVRQRWKHUSHUPLWVLQ WKHDUHD6WDIIUHFRPPHQGVWKLVFRQGLWLRQEHLQFOXGHGDVSDUWRI3=   Page 23 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 3=6WDII5HSRUW3DJH &LW\&RGHIRU3DUNLQJ .0&RXWOLQHVUHTXLUHPHQWVIRURIIVWUHHWSDUNLQJ7KHIROORZLQJGHVFULEHVSDUNLQJ FRQGLWLRQVWKDWPXVWEHPHWE\EHGDQGEUHDNIDVWHVWDEOLVKPHQWV  xKMC 14.20.250(b)(8) Off-Street Parking Requirements 5HTXLUHPHQWV0HW%HGDQGEUHDNIDVWVDUHUHTXLUHGWRKDYHRQHSDUNLQJVSDFHSHU SULQFLSDOGZHOOLQJXQLWDQGRQHSHUJXHVWURRP7KHDSSOLFDQWVSODQWRUHVLGHLQWKH SULQFLSDOGZHOOLQJDQGUHQWRXWWKHWZREHGURRPVLQWKHGD\OLJKWEDVHPHQW7KH\DUH UHTXLUHGWRKDYHWKUHHSDUNLQJVSDFHV3DUNLQJVSDFHIRUWKUHHYHKLFOHVLVORFDWHGVRXWK RIWKHGULYHZD\DQGVXIILFLHQWO\PHHWV.0&SDUNLQJUHTXLUHPHQWV  &LW\&RGHIRU%HGDQG%UHDNIDVW(VWDEOLVKPHQWV  .0&RXWOLQHVVSHFLILFUHTXLUHPHQWVEHGDQGEUHDNIDVWHVWDEOLVKPHQWVZLWKLQWKH&LW\  xKMC 14.20.321(b) Bed and breakfast establishments 5HTXLUHPHQWV0HW%HGDQGEUHDNIDVWVDUHUHTXLUHGWREHRZQHURSHUDWHGHPSOR\QRW PRUHWKDQRQH  SHUVRQRXWVLGHWKHIDPLO\UHQWRXWQRPRUHWKDQWKLUW\SHUFHQW   RIWKHWRWDOIORRUDUHDDQGKDYHDGHTXDWHRIIVWUHHWSDUNLQJ7KHDSSOLFDQWVPHHWWKHVH UHTXLUHPHQWVDVWKHGZHOOLQJWREHUHQWHGZLOOEHRZQHURFFXSLHGQRWHPSOR\DQ\RQH RXWVLGHRIWKHIDPLO\DQGZLOOUHQWRXWQRPRUHWKDQRIWKHWRWDOIORRUDUHD7KH VXEMHFWSURSHUW\PHHWVDOODUHDKHLJKWDQGVHWEDFNUHTXLUHPHQWVRIWKH55]RQH.0&  G UHTXLUHVWKH)LUH0DUVKDOWRLQVSHFWWKHSUHPLVHVIRUFRPSOLDQFHZLWK.0& )LUH&RGHSULRUWRWKHDSSURYDORIWKHFRQGLWLRQDOXVHSHUPLW7KHUHDIWHUWKH SUHPLVHVVKDOOE\LQVSHFWHYHU\RWKHU\HDUE\WKH)LUH0DUVKDOO5HTXLUHPHQWVIRU)LUH &RGHLQVSHFWLRQVDUHOLVWHGDVDUHFRPPHQGHGFRQGLWLRQVRIDSSURYDOIRUWKHFRQGLWLRQDO XVHSHUPLW  5(&200(1'$7,216  &LW\VWDIIILQGWKDWWKHDSSOLFDQWPHHWVWKHFULWHULDIRULVVXDQFHRID&RQGLWLRQDO8VH3HUPLWDVVHW IRUWK LQ VXEVHFWLRQV G   WKURXJK G   RI .HQDL 0XQLFLSDO &RGH  DQG KHUHE\ UHFRPPHQGVWKDWWKH3ODQQLQJDQG=RQLQJ&RPPLVVLRQDSSURYHWKH&RQGLWLRQDO8VH3HUPLW DSSOLFDWLRQVXEMHFWWRWKHIROORZLQJFRQGLWLRQV   $SSOLFDQWPXVWFRPSO\ZLWKDOOIHGHUDO6WDWHRI$ODVNDDQGORFDOUHJXODWLRQV   $ILUHLQVSHFWLRQPXVWEHFRPSOHWHGE\WKH&LW\RI.HQDL)LUH0DUVKDOIRUFRPSOLDQFHZLWK WKH)LUH&RGHSULRUWRUHQWLQJRXWRIWKHURRPVDVGHVFULEHGLQWKLVFRQGLWLRQDOXVHSHUPLW WRFRPSO\ZLWK.HQDL0XQLFLSDO&RGH G    $IWHUWKHLQLWLDOILUHLQVSHFWLRQSULRUWRRSHUDWLQJLQELHQQLDOILUHLQVSHFWLRQVPXVWEH FRPSOHWHGE\WKH)LUH0DUVKDOIRUWKH&LW\RI.HQDLSXUVXDQWWR.HQDL0XQLFLSDO&RGH  G VWDUWLQJLQ   $SSOLFDQWZLOOILOHDQDQQXDOUHSRUWIRUWKH&RQGLWLRQDO8VH3HUPLWDVVHWIRUWKLQ.HQDL 0XQLFLSDO&RGH I SULRUWRWKHVWGD\RI'HFHPEHURIHDFK\HDU  Page 24 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 3=6WDII5HSRUW3DJH  1RPRUHWKDQWKUHH  ERDWVVKDOOEHRSHUDWHGIURPRUVWRUHGDWWKLVORFDWLRQ   3XUVXDQWWR.0& L  WKLVSHUPLWVKDOOH[SLUHDXWRPDWLFDOO\XSRQWHUPLQDWLRQ RULQWHUUXSWLRQRIWKHXVHIRUDSHULRGRIDWOHDVWRQH\HDU  $77$&+0(176  $ 5HVROXWLRQ1R3=  % &RQGLWLRQDO8VH3HUPLW$SSOLFDWLRQ  & 6LWH3ODQ  ' 0DS Page 25 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission _____________________________________________________________________________________      &,7<2).(1$, 3/$11,1*$1'=21,1*&200,66,21 5(62/87,21123=±  $5(62/87,212)7+(3/$11,1*$1'=21,1*&200,66,212)7+(&,7<2).(1$, *5$17,1*$ &21',7,21$/ 86( 3(50,7 )25 7+( 86( 2) $ %(' $1' %5($.)$67 (67$%/,6+0(17$1'*8,'(6(59,&($7$1*/(5'5,9(  $33/,&$17(9$1$1'.$7+<+$5',1*  3523(57<$''5(66$1*/(5'5,9( /(*$/'(6&5,37,21/27%/2&.$1*/(56$&5(668%',9,6,213$57 .(1$,3(1,168/$%2528*+3$5&(/12  :+(5($6DFRPSOHWHDSSOLFDWLRQPHHWLQJWKHUHTXLUHPHQWVRI.HQDL0XQLFLSDO&RGH ZDVVXEPLWWHGWRWKH&LW\RQ)HEUXDU\DQG  :+(5($6WKHDSSOLFDWLRQDIIHFWVODQG]RQHGDV5XUDO5HVLGHQWLDODQG  :+(5($6 WKH DSSOLFDQW KDV GHPRQVWUDWHG ZLWK SODQV DQG RWKHU GRFXPHQWV WKDW WKH UHTXLUHPHQWVRIDEHGDQGEUHDNIDVWHVWDEOLVKPHQWXQGHU.HQDL0XQLFLSDO&RGHDUH PHWDQG  :+(5($6 WKH DSSOLFDQW KDV GHPRQVWUDWHG ZLWK SODQV DQG RWKHU GRFXPHQWV WKDW WKH SUHUHTXLVLWHVRID&RQGLWLRQDO8VH3HUPLWKDYHEHHQPHWSXUVXDQWWR.HQDL0XQLFLSDO&RGH DQG  :+(5($6WKHDSSOLFDQWKDVDJUHHGWRFRQGLWLRQVRIWKHFRQGLWLRQDOXVHSHUPLWWKDWZLOOSURWHFW SXEOLFVDIHW\KHDOWKDQGZHOIDUHIROORZWKHLQWHQWRIWKH5XUDO5HVLGHQWLDO=RQHDQGIROORZ&LW\ UHTXLUHPHQWVRIWKHFRQGLWLRQDOXVHSHUPLWVDQGEHGDQGEUHDNIDVWHVWDEOLVKPHQWV  12:7+(5()25(%(,75(62/9('%<7+(3/$11,1*$1'=21,1*&200,66,212) 7+(&,7<2).(1$,$/$6.$  6HFWLRQ7KDWWKHDSSOLFDQWPHHWVWKHFRQGLWLRQVUHTXLUHGIRUDFRQGLWLRQDOXVHSHUPLWIRUWKH XVHRIEHGDQGEUHDNIDVWDQGJXLGHHVWDEOLVKPHQWVHUYLFHEDVHGRQWKHIROORZLQJILQGLQJV  D  3XUVXDQWWR.HQDL0XQLFLSDO&RGH G  WKHXVHLVFRQVLVWHQWZLWKWKH SXUSRVHRIWKLVFKDSWHUDQGWKHSXUSRVHVDQGLQWHQWRIWKH5XUDO5HVLGHQWLDO=RQHDQG ZRXOGQRWJHQHUDWHKHDY\WUDIILFRUYLRODWHWKHUHVLGHQWLDOFKDUDFWHURIWKHHQYLURQPHQW  E  3XUVXDQWWR.HQDL0XQLFLSDO&RGH G  WKHYDOXHRIWKHDGMRLQLQJSURSHUW\ DQGQHLJKERUKRRGZLOOQRWEHVLJQLILFDQWO\LPSDLUHGDQGVLPLODUEXVLQHVVHVH[LVWLQWKH QHLJKERUKRRG Page 26 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 5HVROXWLRQ1R3= 3DJHRI  F  3XUVXDQWWR.HQDL0XQLFLSDO&RGH G  WKHSURSRVHGXVHLVLQKDUPRQ\ ZLWKWKH&RPSUHKHQVLYH3ODQDQGVXSSRUWVREMHFWLYHVWRFDSLWDOL]HRQWKHWRXULVP LQGXVWU\  G  3XUVXDQWWR.HQDL0XQLFLSDO&RGH G  WKHZHOODQGVHSWLFDQGRWKHU XWLOLWLHV DUH DSSURSULDWH WR VXSSRUW WKH XVH DV VKRZQ LQ $ODVND 'HSDUWPHQW RI (QYLURQPHQWDO&RQVHUYDWLRQGRFXPHQWDWLRQSURYLGHGE\WKHDSSOLFDQW  H  3XUVXDQW WR .HQDL 0XQLFLSDO &RGH  G   WKH SURSRVHG XVH ZLOO QRW EH KDUPIXOWRWKHSXEOLFVDIHW\KHDOWKRUZHOIDUH$EHGDQGEUHDNIDVWDQGJXLGHVHUYLFH ZDVSUHYLRXVO\RSHUDWHGDWWKLVORFDWLRQZLWKRXWDGYHUVHLPSDFWVWRSXEOLFVDIHW\ KHDOWKRUZHOIDUH  I  3XUVXDQWWR.HQDL0XQLFLSDO&RGHWKHSURSRVHGXVHPHHWVUHTXLUHPHQWV IRURIIVWUHHWSDUNLQJZLWKSDUNLQJIRUWKUHHVSDFHVORFDWHGVRXWKRIWKHGULYHZD\  J  3XUVXDQWWR.HQDL0XQLFLSDO&RGHWKHSURSRVHGXVHPHHWVUHTXLUHPHQWV IRUEHGDQGEUHDNIDVWHVWDEOLVKPHQWVDVWKHGZHOOLQJWREHUHQWHGZLOOEHRZQHU RFFXSLHGQRWHPSOR\DQ\RQHRXWVLGHRIWKHIDPLO\DQGZLOOUHQWRXWQRPRUHWKDQ RIWKHWRWDOIORRUDUHD  6HFWLRQ7KDWWKHFRQGLWLRQDOXVHSHUPLWLVVXEMHFWWRWKHIROORZLQJFRQGLWLRQV  D  $SSOLFDQWPXVWFRPSO\ZLWKDOOIHGHUDO6WDWHRI$ODVNDDQGORFDOUHJXODWLRQV  E  $ILUHLQVSHFWLRQPXVWEHFRPSOHWHGE\WKH&LW\RI.HQDL)LUH0DUVKDOIRUFRPSOLDQFH ZLWKWKH)LUH&RGHSULRUWRUHQWLQJRXWRIWKHURRPVDVGHVFULEHGLQWKLVFRQGLWLRQDOXVH SHUPLWWRFRPSO\ZLWK.HQDL0XQLFLSDO&RGH G   F  $IWHUWKHLQLWLDOILUHLQVSHFWLRQSULRUWRRSHUDWLQJLQELHQQLDOILUHLQVSHFWLRQVPXVW EHFRPSOHWHGE\WKH)LUH0DUVKDOIRUWKH&LW\RI.HQDLSXUVXDQWWR.HQDL0XQLFLSDO &RGH G VWDUWLQJLQ  G  $SSOLFDQWZLOOILOHDQDQQXDOUHSRUWIRUWKH&RQGLWLRQDO8VH3HUPLWDVVHWIRUWKLQ.HQDL 0XQLFLSDO&RGH I SULRUWRWKHVWGD\RI'HFHPEHURIHDFK\HDU  H  1RPRUHWKDQWKUHH  ERDWVVKDOOEHRSHUDWHGIURPRUVWRUHGDWWKLVORFDWLRQZKLFK IROORZVSUHFHGHQWHVWDEOLVKHGE\FRQGLWLRQVRQVLPLODUSHUPLWVLQWKHQHLJKERUKRRGWR OLPLWSRWHQWLDOLPSDFWVIURPQRLVHDQGWUDIILFLQWKH5XUDO5HVLGHQWLDO=RQH  I  3XUVXDQW WR .HQDL 0XQLFLSDO &RGH  L   WKLV SHUPLW VKDOO H[SLUH DXWRPDWLFDOO\XSRQWHUPLQDWLRQRULQWHUUXSWLRQRIWKHXVHIRUDSHULRGRIDWOHDVWRQH \HDU   3$66('%<7+(3/$11,1*$1'=21,1*&200,66,212)7+(&,7<2).(1$,$/$6.$ WKLVWKGD\RI0DUFK    Page 27 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 5HVROXWLRQ1R3= 3DJHRI  -())7:$,7&+$,53(5621 $77(67   BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB -$0,(+(,1=&0&&,7<&/(5. Page 28 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 29 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 30 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 31 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 32 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 33 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 34 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 35 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Page 36 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 3$5 77:2 3$5$''112$1*/($1*/(5 6$&5(668%' /2:($'',7,21 75            75 75   $1*/(5'5.  'DWH 7KHLQIRUPDWLRQGHSLFWHGKHUH RQLVIRUJUDSKLFUHSUHVHQWDWLRQ RQO\RIWKHEHVWDYDLODEOHVRXUFHV 7KH&LW\RI.HQDLDVVXPHVQR UHVSRQVLELOLW\IRUHUURUVRQWKLV PDS LQFKHTXDOVIHHW /RW%ORFN $QJOHUV$FUHV6XEGLYLVLRQ 3DUW Page 37 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission THIS PAGE INTENTIONALLY LEFT BLANK Page 38 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Kenai City Council Meeting Page 1 of 3 March 6, 2019 ACTION AGENDA KENAI CITY COUNCIL – REGULAR MEETING MARCH 6, 2019 – 6:00 P.M. KENAI CITY COUNCIL CHAMBERS 210 FIDALGO AVE., KENAI, AK 99611 http://www.kenai.city A. CALL TO ORDER 1. Pledge of Allegiance 2. Roll Call 3. Agenda Approval 4. Consent Agenda (Public comment limited to three (3) minutes per speaker; thirty (30) minutes aggregated) *All items listed with an asterisk (*) are considered to be routine and non-controversial by the council and will be approved by one motion. There will be no separate discussion of these items unless a council member so requests, in which casetheitem will be removed from the consent agenda and considered in its normal sequence on the agenda as part of the General Orders. B. SCHEDULED PUBLIC COMMENTS (Public comment limited to ten (10) minutes per speaker) C. UNSCHEDULED PUBLIC COMMENTS (Public comment limited to three (3) minutes per speaker; thirty (30) minutes aggregated) D. PUBLIC HEARINGS 1.ADOPTED UNANIMOUSLY AS AMENDED.Resolution No. 2019-14 – Authorizing the City Manager to Enter into an Amended Restaurant Concession Agreement for the Kenai Municipal Airport. (Administration) E. MINUTES 1.APPROVED BY THE CONSENT AGENDA.*Work Session Summary of February 20, 2019 2.APPROVED BY THE CONSENT AGENDA.*Regular Meeting of February 20, 2019 F. UNFINISHED BUSINESS 1.ENACTED UNANIMOUSLY AS AMENDED.Ordinance No. 3048-2019 – Amending Kenai Municipal Code Chapter 5.25, Mobile Food Vendors, to Revise Application Requirements, License Terms, and Business Conduct Requirements and Make Other Housekeeping Amendments. (City Clerk) [Clerk’s Note: During the 02/06/19 Meeting, this Item was Postponed to This Meeting; a Motion to Enact is On the Floor.] x Substitute Ordinance No. 3048-2019 Page 39 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Kenai City Council Meeting Page 2 of 3 March 6, 2019 G. NEW BUSINESS 1.APPROVED BY THE CONSENT AGENDA.*Action/Approval – Bills to be Ratified. (Administration) 2.REMOVED FROM THE AGENDA.*Action/Approval – Purchase Orders Exceeding $15,000. (Administration) 3.INTRODUCED BY THE CONSENT AGENDA/PUBLIC HEARING SET FOR 3/20/19. *Ordinance No. 3054-2019 – Accepting Drug Seizure Funds Forfeited to the City in the Amount of $2,153.52 and Appropriating those Funds into the Police Professional Services Account in the Furtherance of Criminal Investigations. (Administration) 4.INTRODUCED BY THE CONSENT AGENDA/PUBLIC HEARING SET FOR 3/20/19. *Ordinance No. 3055-2019 – Accepting and Appropriating a Scholarship from the Alaska Association of Municipal Clerks for Employee Travel and Training. (Administration) 5.INTRODUCED/REFERRED TO PLANNING & ZONING/PUBLIC HEARING SET FOR 4/03/19.*Ordinance No. 3056-2019 – Amending Kenai Municipal Code 14.22.010-Land Use Table, to Allow Business/ Consumer Services and Taxidermy/Gunsmithing in RR1 Zoning District by Conditional Use Permit and Removing the Location Restriction on Professional Offices Allowed by Conditional Use Permit Within the RR1 Zone. (Council Members Peterkin & Glendening) 6.APPROVED UNANIMOUSLY.Action/Approval – Special Use Permit to Kenaitze Indian Tribe for Snow Storage. (Administration) H. COMMISSION/COMMITTEE REPORTS 1. Council on Aging 2. Airport Commission 3. Harbor Commission 4. Parks and Recreation Commission 5. Planning and Zoning Commission 6. Beautification Committee 7. Mini-Grant Steering Committee I. REPORT OF THE MAYOR J. ADMINISTRATION REPORTS 1. City Manager 2. City Attorney 3. City Clerk K. ADDITIONAL PUBLIC COMMENT 1. Citizens Comments (Public comment limited to five (5) minutes per speaker) Page 40 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Kenai City Council Meeting Page 3 of 3 March 6, 2019 2. Council Comments L. EXECUTIVE SESSION M. PENDING ITEMS –None. N. ADJOURNMENT **************************************************************************************************** INFORMATION ITEMS 1. Purchase Orders between $2,500 and $15,000 for Council Review 2. Kenai Historical Society Newsletter – February 2019 The agenda and supporting documents are posted on the City’s website at www.kenai.city. Copies of resolutions and ordinances are available at the City Clerk’s Office or outside the Council Chamber prior to the meeting. For additional information, please contact the City Clerk’s Office at 907-283-8231. Page 41 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission THIS PAGE INTENTIONALLY LEFT BLANK Page 42 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 144 N. Binkley Street, Soldotna, Alaska 99669 (907) 714-2200 (907) 714-2378 Fax Office of the Borough Clerk Betty J. Glick Assembly Chambers, Kenai Peninsula Borough George A. Navarre Administration Building Paulette Bokenko-Carluccio – City of Seldovia • Jeremy Brantley – Sterling Blair Martin – Kalifornsky Beach • Paul Whitney – City of Soldotna Alternates: Virginia Morgan – East Peninsula Plat Committee Tentative Agenda March 11, 2019 7:00 p.m. A. CALL TO ORDER B. ROLL CALL C. APPROVAL OF AGENDA, EXCUSED ABSENCES, AND MINUTES 1. Agenda 2. Member/Alternate Excused Absences 3. Minutes a. February 25, 2019 Plat Committee Minutes D. PUBLIC COMMENT (Items other than those appearing on the agenda. Limited to five minutes per speaker unless previous arrangements are made.) E. SUBDIVISION PLAT PUBLIC HEARINGS 1. Spur Vista Subdivision 2019 Replat KPB 2019-006 [Segesser Surveys / Bolstridge] Location: on Josiah Spurr Court and Kalifornsky Beach Road, Kalifornsky 2. Seward Original Townsite Petersen Replat KPB 2019-011 [Johnson Surveying / Petersen] Location: on Third Avenue, off Monroe Street, City of Seward 3. Herrin Subdivision 2019 Addition KPB File 2019-012 [Johnson Surveying / Koberstein] Location: On Lost Street and Blithe Court, Cohoe F. FINAL SUBDIVISION PLAT PUBLIC HEARING - None G. OTHER / NEW BUSINESS H. MISCELLANEOUS INFORMATION – NO ACTION REQUIRED I. ADJOURNMENT Page 43 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Plat Committee Tentative Agenda March 11, 2019 Page 2 NEXT REGULARLY SCHEDULED MEETING The next regularly scheduled Plat Committee meeting will be held Monday, March 25, 2019 in the Betty J. Glick Assembly Chambers of the Kenai Peninsula Borough George A. Navarre Administration Building, 144 North Binkley, Soldotna, Alaska at 5:30 p.m. PLANNING DEPARTMENT Phone: 907-714-2215 Fax: 907-714-2378 Phone: toll free within the Borough 1-800-478-4441, extension 2215 e-mail address: planning@kpb.us web site: http://www.kpb.us/planning-dept/planning-home Page 44 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission 144 N. Binkley Street, Soldotna, Alaska 99669 (907) 714-2215 (907) 714-2378 Fax Office of the Borough Clerk Betty J. Glick Assembly Chambers, Kenai Peninsula Borough George A. Navarre Administration Building Max J. Best, Planning Director • Charlie Pierce, Borough Mayor Blair Martin, Chairman – Kalifornsky Beach • Robert Ruffner, Vice Chairman – Kasilof/Clam Gulch Dr. Rick Foster, Parliamentarian – Southwest Borough • Syverine Abrahamson-Bentz – Anchor Point/Ninilchik Jeremy Brantley – Sterling • Paulette Bokenko-Carluccio – City of Seldovia • Cindy Ecklund – City of Seward Robert F. Ernst – Northwest Borough • Diane Fikes – City of Kenai • Virginia Morgan – East Peninsula Franco Venuti – City of Homer • Paul Whitney – City of Soldotna Planning Commission Tentative Agenda March 11, 2019 7:30 p.m. A. CALL TO ORDER B. ROLL CALL C. APPROVAL OF CONSENT AND REGULAR AGENDA All items marked with an asterisk (*) are consent agenda items. Consent agenda items are considered routine and non-controversial by the Planning Commission and will be approved by one motion. There will be no separate discussion of consent agenda items unless a Planning Commissioner so requests in which case the item will be removed from the consent agenda and considered in its normal sequence on the regular agenda. If you wish to comment on a consent agenda item or a regular agenda item other than a public hearing, please advise the recording secretary before the meeting begins, and she will inform the Chairman of your wish to comment. *1. Time Extension Request - None *2. Planning Commission Resolutions - None *3. Plats Granted Administrative Approval - None *4. Plats Granted Final Approval (20.10.070) - None *5. Plat Amendment Request - None *6. Utility Easement Vacations - None *7. Commissioner Excused Absences a. Robert F. Ernst, Northwest Borough b. Vacant, Ridgeway *8. Minutes a. February 25, 2019 Planning Commission Minutes D. PUBLIC COMMENT/PRESENTATIONS/COMMISSIONERS (Items other than those appearing on the agenda. Limited to five minutes per speaker unless previous arrangements are made.) Page 45 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Planning Commission Tentative Agenda March 11, 2019 Page 2 E. UNFINISHED BUSINESS F. PUBLIC HEARINGS 1. Public hearing on a Limited Marijuana Cultivation Facility license in the Nikiski area to provide comment to the State of Alaska. Applicant: AK Gold, LLC. Landowner: Mark F. Powell. Parcel Number: 015-010-57. Property Description: Lot 1, Swanson Alaska Subdivision, Waggoner / Powell Replat, according to Plat 2005-85, Kenai Recording District. Location: 46657 Kenai Spur Hwy. 2. Ordinance 2019-__, Amending KPB 21.45.040 Zoning a 160-Acre Parcel Creating the Murwood South Single Family Residential R-1 Local Option Zoning District. G. ANADROMOUS WATERS HABITAT PROTECTION DISTRICT (21.18) 1. Resolution 2019-09; A Conditional Use Permit (CUP) to replace an existing golf cart bridge with a new bridge and golf cart path within the 50-foot Habitat Protection District of an unnamed anadromous stream (Anadromous Waters Catalog #244-30- 10010-2007). This project is located on both banks of the unnamed anadromous stream PNT GLS 1, 2, 3, & 4 Per Lse Amds 395-749 & 395-754 excluding Five Irons Heights Subdivision, Section 3, Township 5 North, Range 11 West, City of Kenai, Seward Meridian, Kenai Peninsula Borough, Alaska. Parcel: 049-382-16. Applicant: City of Kenai, Parks and Rec Department H. VACATIONS NOT REQUIRING A PUBLIC HEARING - None I. SPECIAL CONSIDERATIONS 1. Time Extension Request Epperheimer Subdivision KPB File 2015-036 [No Surveyor / Epperheimer] Location: On Borgen Avenue and Sam Street, Salamatoff J. SUBDIVISION PLAT PUBLIC HEARINGS 1. The Plat Committee will review 3 preliminary plat. K. OTHER/NEW BUSINESS L. ASSEMBLY COMMENTS M. LEGAL REPRESENTATIVE COMMENTS N. DIRECTOR'S COMMENTS O. COMMISSIONER COMMENTS Page 46 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission Planning Commission Tentative Agenda March 11, 2019 Page 3 P. PENDING ITEMS FOR FUTURE ACTION Q. ADJOURNMENT MISCELLANEOUS INFORMATIONAL ITEMS NO ACTION REQUIRED NEXT REGULARY SCHEDULED PLANNING COMMISSION MEETING The next regularly scheduled Planning Commission meeting will be held Monday, March 25, 2019 in the Betty J. Glick Assembly Chambers of the Kenai Peninsula Borough George A. Navarre Administration Building, 144 North Binkley St, Soldotna, Alaska at 7:30 p.m. ADVISORY PLANNING COMMISSION MEETINGS NOTE: Advisory planning commission meetings are subject to change. Please verify the meeting date, location, and time with the advisory planning commission chairperson. Chairperson contact information is on each advisory planning commission website, which is linked to the Planning Department website. CONTACT INFORMATION KENAI PENINSULA BOROUGH PLANNING DEPARTMENT Phone: 907-714-2215 Phone: toll free within the Borough 1-800-478-4441, extension 2215 Fax: 907-714-2378 e-mail address: planning@kpb.us website: http://www.kpb.us/planning-dept/planning-home ADVISORY COMMISSION MEETING LOCATION DATE TIME Anchor Point Anchor Point Chamber of Commerce April 3, 2019 7:00 p.m. Cooper Landing Cooper Landing Community Hall April 3, 2019 6:00 p.m. Moose Pass Moose Pass Community Hall TBD 6:30 p.m. Hope / Sunrise Hope Social Hall TBD 6:00 p.m. The Kachemak Bay and Funny River Advisory Planning Commissions are inactive at this time. Page 47 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission THIS PAGE INTENTIONALLY LEFT BLANK Page 48 of 48 March 13, 2019 City of Kenai Planning and Zoning Commission